PDB entry 1p1a

View 1p1a on RCSB PDB site
Description: NMR structure of ubiquitin-like domain of hHR23B
Class: DNA binding protein
Keywords: ubiquitin-like, DNA binding protein
Deposited on 2003-04-11, released 2004-07-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: UV excision repair protein RAD23 homolog B
  Species: Homo sapiens [TaxId:9606]
  Gene: hHR23B
  Database cross-references and differences (RAF-indexed):
  • Uniprot P54727 (3-84)
    • cloning artifact (0-2)
  Domains in SCOPe 2.04: d1p1aa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1p1aA (A:)
  gshmqvtlktlqqqtfkididpeetvkalkekiesekgkdafpvagqkliyagkilnddt
  alkeykideknfvvvmvtkpkavst