PDB entry 1p17

View 1p17 on RCSB PDB site
Description: Hypoxanthine Phosphoribosyltransferase from Trypanosoma cruzi, K68R mutant, complexed with the product IMP
Class: transferase
Keywords: transferase, glycosyltransferase, phosphoribosyltransferase, nucleotide metabolism, purine salvage, product complex
Deposited on 2003-04-11, released 2004-05-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.201
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypoxanthine phosphoribosyltransferase
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: HGPRT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27796
      • see remark 999 (22)
      • engineered (51)
      • see remark 999 (65)
    Domains in SCOPe 2.06: d1p17a_
  • Chain 'B':
    Compound: hypoxanthine phosphoribosyltransferase
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: HGPRT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27796
      • see remark 999 (22)
      • engineered (51)
      • see remark 999 (65)
    Domains in SCOPe 2.06: d1p17b_
  • Chain 'C':
    Compound: hypoxanthine phosphoribosyltransferase
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: HGPRT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27796
      • see remark 999 (22)
      • engineered (51)
      • see remark 999 (65)
    Domains in SCOPe 2.06: d1p17c_
  • Chain 'D':
    Compound: hypoxanthine phosphoribosyltransferase
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: HGPRT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27796
      • see remark 999 (22)
      • engineered (51)
      • see remark 999 (65)
    Domains in SCOPe 2.06: d1p17d_
  • Heterogens: IMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p17A (A:)
    mpreyefaekilfteeeirtrikevakriaddykgkglrpyvnplvlisvlrgsfmftad
    lcralcdfnvpvrmeficvssygegltssgqvrmlldtrhsieghhvlivedivdtaltl
    nylyhmyftrrpaslktvvlldkregrrvpfsadyvvanipnafvigygldyddtyrelr
    divvlrpevyaereaarqkkqraigsadtdrdakrefhsky
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p17A (A:)
    preyefaekilfteeeirtrikevakriaddykgkglrpyvnplvlisvlrgsfmftadl
    cralcdfnvpvrmeficvssygtssgqvrmlldtrhsieghhvlivedivdtaltlnyly
    hmyftrrpaslktvvlldkregrrvpfsadyvvanipnafvigygldyddtyrelrdivv
    lrpevyaereaarq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p17B (B:)
    mpreyefaekilfteeeirtrikevakriaddykgkglrpyvnplvlisvlrgsfmftad
    lcralcdfnvpvrmeficvssygegltssgqvrmlldtrhsieghhvlivedivdtaltl
    nylyhmyftrrpaslktvvlldkregrrvpfsadyvvanipnafvigygldyddtyrelr
    divvlrpevyaereaarqkkqraigsadtdrdakrefhsky
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p17B (B:)
    preyefaekilfteeeirtrikevakriaddykgkglrpyvnplvlisvlrgsfmftadl
    cralcdfnvpvrmeficvssysgqvrmlldtrhsieghhvlivedivdtaltlnylyhmy
    ftrrpaslktvvlldkregrrvpfsadyvvanipnafvigygldyddtyrelrdivvlrp
    evyaereaarqkkqraigsadtdr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1p17C (C:)
    mpreyefaekilfteeeirtrikevakriaddykgkglrpyvnplvlisvlrgsfmftad
    lcralcdfnvpvrmeficvssygegltssgqvrmlldtrhsieghhvlivedivdtaltl
    nylyhmyftrrpaslktvvlldkregrrvpfsadyvvanipnafvigygldyddtyrelr
    divvlrpevyaereaarqkkqraigsadtdrdakrefhsky
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p17C (C:)
    preyefaekilfteeeirtrikevakriaddykgkglrpyvnplvlisvlrgsfmftadl
    cralcdfnvpvrmeficvssygessgqvrmlldtrhsieghhvlivedivdtaltlnyly
    hmyftrrpaslktvvlldkregrrvpfsadyvvanipnafvigygldyddtyrelrdivv
    lrpevyaereaa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1p17D (D:)
    mpreyefaekilfteeeirtrikevakriaddykgkglrpyvnplvlisvlrgsfmftad
    lcralcdfnvpvrmeficvssygegltssgqvrmlldtrhsieghhvlivedivdtaltl
    nylyhmyftrrpaslktvvlldkregrrvpfsadyvvanipnafvigygldyddtyrelr
    divvlrpevyaereaarqkkqraigsadtdrdakrefhsky
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p17D (D:)
    preyefaekilfteeeirtrikevakriaddykgkglrpyvnplvlisvlrgsfmftadl
    cralcdfnvpvrmeficvssyvrmlldtrhsieghhvlivedivdtaltlnylyhmyftr
    rpaslktvvlldkregrrvpfsadyvvanipnafvigygldyddtyrelrdivvlrpevy
    aereaarq