PDB entry 1p16

View 1p16 on RCSB PDB site
Description: Structure of an mRNA capping enzyme bound to the phosphorylated carboxyl-terminal domain of RNA polymerase II
Class: transferase
Keywords: guanylyltransferase, candida albicans, RNA polymerase II, transcription, capping, ctd, mRNA
Deposited on 2003-04-11, released 2003-07-15
The last revision prior to the SCOP 1.75 freeze date was dated 2003-07-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.2
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mRNA capping enzyme alpha subunit
    Species: Candida albicans
    Gene: CGT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78587 (0-End)
      • cloning artifact (0)
      • engineered (1)
      • cloning artifact (27)
      • cloning artifact (57)
      • cloning artifact (170)
      • cloning artifact (198)
      • cloning artifact (211)
      • cloning artifact (337)
    Domains in SCOP 1.75: d1p16a1, d1p16a2
  • Chain 'B':
    Compound: mRNA capping enzyme alpha subunit
    Species: Candida albicans
    Gene: CGT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78587 (0-End)
      • cloning artifact (0)
      • engineered (1)
      • cloning artifact (27)
      • cloning artifact (57)
      • cloning artifact (170)
      • cloning artifact (198)
      • cloning artifact (211)
      • cloning artifact (337)
    Domains in SCOP 1.75: d1p16b1, d1p16b2
  • Chain 'C':
    Compound: phosphorylated peptide from C-terminal of RNA polymerase II
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: phosphorylated peptide from C-terminal of RNA polymerase II
    Species: synthetic, synthetic
  • Heterogens: PO4, G, GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p16A (A:)
    mvqleereipvipgnkldeeetkelrlmvaellgrrntgfpgsqpvsferrhleetlmqk
    dyfvcektdglrcllflindpdkgegvflvtrendyyfipnihfplsvnetrekptyhhg
    tlldgelvlenrnvsepvlryvifdalaihgkciidrplpkrlgyitenvmkpfdnfkkh
    npdivnspefpfkvgfktmltsyhaddvlskmdklfhasdgliytcaetpyvfgtdqtll
    kwkpaeentvdfqlefvfnevqdpdlderdptstyldydakpnliklrvwqgsnvhtdfa
    kldlsdddwerlkaleqplqgriaecrqsttkkgywemlrfrndksngnhisvvekilvs
    ikdgvkekeviewcpkisrawkkrendrrqkhfng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p16A (A:)
    mvqleereipvipgnkldeeetkelrlmvaellgrrntgfpgsqpvsferrhleetlmqk
    dyfvcektdglrcllflindpdkgegvflvtrendyyfipnihfplsvnetrekptyhhg
    tlldgelvlenrnvsepvlryvifdalaihgkciidrplpkrlgyitenvmkpfdnfkkh
    npdivnspefpfkvgfktmltsyhaddvlskmdklfhasdgliytcaetpyvfgtdqtll
    kwkpaeentvdfqlefvfnevqdpdlderdptstyldydakpnliklrvwqgsnvhtdfa
    kldlsdddwerlkaleqplqgriaecrqsttkkgywemlrfrndksngnhisvvekilvs
    ikdgvkekeviewcpkisrawkkrendrrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p16B (B:)
    mvqleereipvipgnkldeeetkelrlmvaellgrrntgfpgsqpvsferrhleetlmqk
    dyfvcektdglrcllflindpdkgegvflvtrendyyfipnihfplsvnetrekptyhhg
    tlldgelvlenrnvsepvlryvifdalaihgkciidrplpkrlgyitenvmkpfdnfkkh
    npdivnspefpfkvgfktmltsyhaddvlskmdklfhasdgliytcaetpyvfgtdqtll
    kwkpaeentvdfqlefvfnevqdpdlderdptstyldydakpnliklrvwqgsnvhtdfa
    kldlsdddwerlkaleqplqgriaecrqsttkkgywemlrfrndksngnhisvvekilvs
    ikdgvkekeviewcpkisrawkkrendrrqkhfng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p16B (B:)
    mvqleereipvipgnkldeeetkelrlmvaellgrrntgfpgsqpvsferrhleetlmqk
    dyfvcektdglrcllflindpdkgegvflvtrendyyfipnihfplsvnetrekptyhhg
    tlldgelvlenrnvsepvlryvifdalaihgkciidrplpkrlgyitenvmkpfdnfkkh
    npdivnspefpfkvgfktmltsyhaddvlskmdklfhasdgliytcaetpyvfgtdqtll
    kwkpaeentvdfqlefvfnevqyldydakpnliklrvwqgsnvhtdfakldlsdddwerl
    kaleqplqgriaecrqsttkkgywemlrfrndksngnhisvvekilvsikdgvkekevie
    wcpkisrawkkrendrr
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.