PDB entry 1p15

View 1p15 on RCSB PDB site
Description: Crystal structure of the D2 domain of RPTPa
Deposited on 2003-04-11, released 2003-08-19
The last revision prior to the SCOP 1.67 freeze date was dated 2003-08-19, with a file datestamp of 2003-08-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.203
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1p15a_
  • Chain 'B':
    Domains in SCOP 1.67: d1p15b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p15A (A:)
    mrtgnlpanmkknrvlqiipyefnrviipvkrgeentdyvnasfidgyrqkdsyiasqgp
    llhtiedfwrmiwewkscsivmlteleergqekcaqywpsdglvsygditvelkkeeece
    sytvrdllvtntrenksrqirqfhfhgwpevgipsdgkgminiiaavqkqqqqsgnhpit
    vhcsagagrtgtfcalstvlervkaegildvfqtvkslrlqrphmvqtleqyefcykvvq
    eyidafsdyanfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p15A (A:)
    mrtgnlpanmkknrvlqiipyefnrviipvkrgeentdyvnasfidgyrqkdsyiasqgp
    llhtiedfwrmiwewkscsivmlteleergqekcaqywpsdglvsygditvelkkeeece
    sytvrdllvtntrenksrqirqfhfhgwpevgipsdgkgminiiaavqkqqqqsgnhpit
    vhcsagagrtgtfcalstvlervkaegildvfqtvkslrlqrphmvqtleqyefcykvvq
    eyida
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p15B (B:)
    mrtgnlpanmkknrvlqiipyefnrviipvkrgeentdyvnasfidgyrqkdsyiasqgp
    llhtiedfwrmiwewkscsivmlteleergqekcaqywpsdglvsygditvelkkeeece
    sytvrdllvtntrenksrqirqfhfhgwpevgipsdgkgminiiaavqkqqqqsgnhpit
    vhcsagagrtgtfcalstvlervkaegildvfqtvkslrlqrphmvqtleqyefcykvvq
    eyidafsdyanfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p15B (B:)
    mrtgnlpanmkknrvlqiipyefnrviipvkrgeentdyvnasfidgyrqkdsyiasqgp
    llhtiedfwrmiwewkscsivmlteleergqekcaqywpsdglvsygditvelkkeeece
    sytvrdllvtntenksrqirqfhfhgwpevgipsdgkgminiiaavqkqqqqsgnhpitv
    hcsagagrtgtfcalstvlervkaegildvfqtvkslrlqrphmvqtleqyefcykvvqe
    yidafs