PDB entry 1p14

View 1p14 on RCSB PDB site
Description: Crystal structure of a catalytic-loop mutant of the insulin receptor tyrosine kinase
Class: transferase
Keywords: receptor, tyrosine kinase, catalysis, mutant, transferase
Deposited on 2003-04-11, released 2003-07-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.224
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Insulin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06213 (0-305)
      • engineered (3)
      • engineered (154)
    Domains in SCOPe 2.05: d1p14a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p14A (A:)
    vfpssvyvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesas
    lrerieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaen
    npgrppptlqemiqmaaeiadgmaylnakkfvhrnlaarncmvahdftvkigdfgmtrdi
    yetdyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneq
    vlkfvmdggyldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsff
    hseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p14A (A:)
    vfpssvyvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesas
    lrerieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaen
    npgrppptlqemiqmaaeiadgmaylnakkfvhrnlaarncmvahdftvkigdfgpvrwm
    apeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvmdggyldqpdncpe
    rvtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsffhseenk