PDB entry 1p0z

View 1p0z on RCSB PDB site
Description: Sensor Kinase CitA binding domain
Class: transferase
Keywords: Transferase, Kinase
Deposited on 2003-04-11, released 2003-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-10, with a file datestamp of 2014-09-05.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.168
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sensor kinase citA
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: CITA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52687 (0-130)
      • expression tag (129-130)
    Domains in SCOPe 2.07: d1p0za1, d1p0za2
  • Chain 'B':
    Compound: Sensor kinase citA
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: CITA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52687 (0-130)
      • expression tag (129-130)
    Domains in SCOPe 2.07: d1p0zb1, d1p0zb2
  • Chain 'C':
    Compound: Sensor kinase citA
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: CITA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52687 (0-130)
      • expression tag (129-130)
    Domains in SCOPe 2.07: d1p0zc1, d1p0zc2
  • Chain 'D':
    Compound: Sensor kinase citA
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: CITA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52687 (0-130)
      • expression tag (129-130)
    Domains in SCOPe 2.07: d1p0zd1, d1p0zd2
  • Chain 'E':
    Compound: Sensor kinase citA
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: CITA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52687 (0-130)
      • expression tag (129-130)
    Domains in SCOPe 2.07: d1p0ze1, d1p0ze2
  • Chain 'F':
    Compound: Sensor kinase citA
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: CITA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52687 (0-130)
      • expression tag (129-130)
    Domains in SCOPe 2.07: d1p0zf1, d1p0zf2
  • Chain 'G':
    Compound: Sensor kinase citA
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: CITA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52687 (0-130)
      • expression tag (129-130)
    Domains in SCOPe 2.07: d1p0zg1, d1p0zg2
  • Chain 'H':
    Compound: Sensor kinase citA
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: CITA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52687 (0-130)
      • expression tag (129-130)
    Domains in SCOPe 2.07: d1p0zh1, d1p0zh2
  • Chain 'I':
    Compound: Sensor kinase citA
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: CITA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52687 (0-130)
      • expression tag (129-130)
    Domains in SCOPe 2.07: d1p0zi1, d1p0zi2
  • Chain 'J':
    Compound: Sensor kinase citA
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: CITA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52687 (0-130)
      • expression tag (129-130)
    Domains in SCOPe 2.07: d1p0zj1, d1p0zj2
  • Heterogens: FLC, NA, MO7, OMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p0zA (A:)
    eerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdasg
    qrlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgkvigivs
    vgytieqlehh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p0zB (B:)
    eerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdasg
    qrlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgkvigivs
    vgytieqlehh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p0zC (C:)
    eerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdasg
    qrlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgkvigivs
    vgytieqlehh
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p0zD (D:)
    eerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdasg
    qrlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgkvigivs
    vgytieqlehh
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p0zE (E:)
    eerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdasg
    qrlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgkvigivs
    vgytieqlehh
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p0zF (F:)
    eerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdasg
    qrlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgkvigivs
    vgytieqlehh
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p0zG (G:)
    eerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdasg
    qrlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgkvigivs
    vgytieqlehh
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p0zH (H:)
    eerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdasg
    qrlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgkvigivs
    vgytieqlehh
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p0zI (I:)
    eerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdasg
    qrlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgkvigivs
    vgytieqlehh
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p0zJ (J:)
    eerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdasg
    qrlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgkvigivs
    vgytieqlehh