PDB entry 1p0y

View 1p0y on RCSB PDB site
Description: Crystal structure of the SET domain of LSMT bound to MeLysine and AdoHcy
Class: transferase
Keywords: set domain, lysine n-methylation, multiple methylation, photosynthesis, post-translational modification
Deposited on 2003-04-11, released 2003-07-01
The last revision prior to the SCOP 1.73 freeze date was dated 2003-07-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.228
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplast
    Species: Pisum sativum
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q43088 (Start-437)
      • engineered (438-441)
    Domains in SCOP 1.73: d1p0ya1, d1p0ya2
  • Chain 'B':
    Compound: Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplast
    Species: Pisum sativum
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q43088 (Start-437)
      • engineered (438-443)
    Domains in SCOP 1.73: d1p0yb1, d1p0yb2
  • Chain 'C':
    Compound: Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplast
    Species: Pisum sativum
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q43088 (Start-437)
      • engineered (438-442)
    Domains in SCOP 1.73: d1p0yc1, d1p0yc2
  • Heterogens: SAH, MLZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p0yA (A:)
    mtepslspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlw
    inpdavaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseee
    lqelqgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsraf
    srlrnenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvy
    iqydlnksnaelaldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfd
    ifynrtlppgllpylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreac
    ksalagyhttieqdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyy
    qerrlkdlglcgengdilenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p0yA (A:)
    slspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpd
    avaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqel
    qgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlr
    nenlvvvpmadlinhsagvttedhayevkdylfslksplsvkageqvyiqydlnksnael
    aldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfdifynrtlppgll
    pylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreacksalagyhttie
    qdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyyqerrlkdlglcg
    engdilenly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p0yB (B:)
    mtepslspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlw
    inpdavaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseee
    lqelqgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsraf
    srlrnenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvy
    iqydlnksnaelaldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfd
    ifynrtlppgllpylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreac
    ksalagyhttieqdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyy
    qerrlkdlglcgengdilenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p0yB (B:)
    pslspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinp
    davaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqe
    lqgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrl
    rnenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqy
    dlnksnaelaldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfdify
    nrtlppgllpylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreacksa
    lagyhttieqdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyyqer
    rlkdlglcgengdilenlyfq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1p0yC (C:)
    mtepslspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlw
    inpdavaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseee
    lqelqgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsraf
    srlrnenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvy
    iqydlnksnaelaldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfd
    ifynrtlppgllpylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreac
    ksalagyhttieqdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyy
    qerrlkdlglcgengdilenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p0yC (C:)
    slspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpd
    avaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqel
    qgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlr
    nenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqyd
    lnksnaelaldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfdifyn
    rtlppgllpylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreacksal
    agyhttieqdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyyqerr
    lkdlglcgengdilenlyf