PDB entry 1p0y

View 1p0y on RCSB PDB site
Description: crystal structure of the set domain of lsmt bound to melysine and adohcy
Deposited on 2003-04-11, released 2003-07-01
The last revision prior to the SCOP 1.69 freeze date was dated 2003-07-01, with a file datestamp of 2003-07-01.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.228
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p0yA (A:)
    mtepslspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlw
    inpdavaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseee
    lqelqgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsraf
    srlrnenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvy
    iqydlnksnaelaldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfd
    ifynrtlppgllpylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreac
    ksalagyhttieqdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyy
    qerrlkdlglcgengdilenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p0yA (A:)
    slspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpd
    avaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqel
    qgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlr
    nenlvvvpmadlinhsagvttedhayevkdylfslksplsvkageqvyiqydlnksnael
    aldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfdifynrtlppgll
    pylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreacksalagyhttie
    qdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyyqerrlkdlglcg
    engdilenly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p0yB (B:)
    mtepslspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlw
    inpdavaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseee
    lqelqgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsraf
    srlrnenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvy
    iqydlnksnaelaldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfd
    ifynrtlppgllpylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreac
    ksalagyhttieqdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyy
    qerrlkdlglcgengdilenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p0yB (B:)
    pslspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinp
    davaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqe
    lqgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrl
    rnenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqy
    dlnksnaelaldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfdify
    nrtlppgllpylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreacksa
    lagyhttieqdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyyqer
    rlkdlglcgengdilenlyfq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1p0yC (C:)
    mtepslspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlw
    inpdavaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseee
    lqelqgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsraf
    srlrnenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvy
    iqydlnksnaelaldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfd
    ifynrtlppgllpylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreac
    ksalagyhttieqdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyy
    qerrlkdlglcgengdilenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p0yC (C:)
    slspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpd
    avaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqel
    qgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlr
    nenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqyd
    lnksnaelaldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfdifyn
    rtlppgllpylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreacksal
    agyhttieqdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyyqerr
    lkdlglcgengdilenlyf