PDB entry 1p0r

View 1p0r on RCSB PDB site
Description: Solution Structure of UBL5 a human Ubiquitin-Like Protein
Deposited on 2003-04-10, released 2003-10-28
The last revision prior to the SCOP 1.67 freeze date was dated 2003-10-28, with a file datestamp of 2003-10-28.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1p0ra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p0rA (A:)
    mgsshhhhhhssglvprgshmievvcndrlgkkvrvkcntddtigdlkkliaaqtgtrwn
    kivlkkwytifkdhvslgdyeihdgmnlelyyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p0rA (A:)
    mievvcndrlgkkvrvkcntddtigdlkkliaaqtgtrwnkivlkkwytifkdhvslgdy
    eihdgmnlelyyq