PDB entry 1p0r

View 1p0r on RCSB PDB site
Description: Solution Structure of UBL5 a human Ubiquitin-Like Protein
Class: protein binding
Keywords: Ubiquitin-like fold, PROTEIN BINDING
Deposited on 2003-04-10, released 2003-10-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-like 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1p0ra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p0rA (A:)
    mgsshhhhhhssglvprgshmievvcndrlgkkvrvkcntddtigdlkkliaaqtgtrwn
    kivlkkwytifkdhvslgdyeihdgmnlelyyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p0rA (A:)
    mievvcndrlgkkvrvkcntddtigdlkkliaaqtgtrwnkivlkkwytifkdhvslgdy
    eihdgmnlelyyq