PDB entry 1p0i

View 1p0i on RCSB PDB site
Description: Crystal structure of human butyryl cholinesterase
Class: hydrolase
Keywords: Serine hydrolase, butyrate
Deposited on 2003-04-10, released 2003-08-05
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cholinesterase
    Species: HOMO SAPIENS
    Gene: BCHE OR CHE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06276 (Start-528)
      • engineered (16)
      • engineered (480)
      • engineered (485)
    Domains in SCOP 1.73: d1p0ia_
  • Heterogens: NAG, SO4, CL, BUA, MES, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p0iA (A:)
    eddiiiatkngkvrgmqltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatk
    yansccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqt
    gtsslhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqk
    niaafggnpksvtlfgesagaasvslhllspgshslftrailqsgsfnapwavtslyear
    nrtlnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdflt
    dmpdillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpg
    vsefgkesilfhytdwvddqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyy
    fehrssklpwpewmgvmhgyeiefvfglplerrdqytkaeeilsrsivkrwanfakygnp
    qetqnqstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p0iA (A:)
    iiiatkngkvrgmqltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatkyan
    sccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqtgts
    slhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqknia
    afggnpksvtlfgesagaasvslhllspgshslftrailqsgsfnapwavtslyearnrt
    lnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdfltdmp
    dillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpgvse
    fgkesilfhytdwvqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyyfehrs
    sklpwpewmgvmhgyeiefvfglplerrdytkaeeilsrsivkrwanfakygnpqetqnq
    stswpvfksteqkyltlntestrimtklraqqcrfwtsffpkv