PDB entry 1p0c

View 1p0c on RCSB PDB site
Description: Crystal Structure of the NADP(H)-Dependent Vertebrate Alcohol Dehydrogenase (ADH8)
Class: oxidoreductase
Keywords: adh topology, nadp(h)-dependent, oxidoreductase
Deposited on 2003-04-10, released 2003-04-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADP-dependent alcohol dehydrogenase
    Species: Rana perezi [TaxId:8403]
    Gene: ADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57380
      • conflict (141)
    Domains in SCOPe 2.06: d1p0ca1, d1p0ca2
  • Chain 'B':
    Compound: NADP-dependent alcohol dehydrogenase
    Species: Rana perezi [TaxId:8403]
    Gene: ADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57380 (Start-372)
      • conflict (141)
    Domains in SCOPe 2.06: d1p0cb1, d1p0cb2
  • Heterogens: ZN, PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p0cA (A:)
    mctagkditckaavawephkplsletitvappkahevrikilasgicgsdssvlkeiips
    kfpvilgheavgvvesigagvtcvkpgdkviplfvpqcgscrackssnsnfcekndmgak
    tglmadmtsrftcrgkpiynlmgtstfteytvvadiavakidpkaplescligcgfatgy
    gaavntakvtpgstcavfglggvgfsaivgckaagasriigvgthkdkfpkaielgatec
    lnpkdydkpiyevicektnggvdyavecagrietmmnalqstycgsgvtvvlglaspner
    lpldplllltgrslkgsvfggfkgeevsrlvddymkkkinvnflvstkltldqinkafel
    lssgqgvrsimiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p0cA (A:)
    ctagkditckaavawephkplsletitvappkahevrikilasgicgsdssvlkeiipsk
    fpvilgheavgvvesigagvtcvkpgdkviplfvpqcgscrackssnsnfcekndmgakt
    glmadmtsrftcrgkpiynlmgtstfteytvvadiavakidpkaplescligcgfatgyg
    aavntakvtpgstcavfglggvgfsaivgckaagasriigvgthkdkfpkaielgatecl
    npkdydkpiyevicektnggvdyavecagrietmmnalqstycgsgvtvvlglaspnerl
    pldplllltgrslkgsvfggfkgeevsrlvddymkkkinvnflvstkltldqinkafell
    ssgqgvrsimiy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p0cB (B:)
    mctagkditckaavawephkplsletitvappkahevrikilasgicgsdssvlkeiips
    kfpvilgheavgvvesigagvtcvkpgdkviplfvpqcgscrackssnsnfcekndmgak
    tglmadmtsrftcrgkpiynlmgtstfteytvvadiavakidpkaplescligcgfatgy
    gaavntakvtpgstcavfglggvgfsaivgckaagasriigvgthkdkfpkaielgatec
    lnpkdydkpiyevicektnggvdyavecagrietmmnalqstycgsgvtvvlglaspner
    lpldplllltgrslkgsvfggfkgeevsrlvddymkkkinvnflvstkltldqinkafel
    lssgqgvrsimiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p0cB (B:)
    ctagkditckaavawephkplsletitvappkahevrikilasgicgsdssvlkeiipsk
    fpvilgheavgvvesigagvtcvkpgdkviplfvpqcgscrackssnsnfcekndmgakt
    glmadmtsrftcrgkpiynlmgtstfteytvvadiavakidpkaplescligcgfatgyg
    aavntakvtpgstcavfglggvgfsaivgckaagasriigvgthkdkfpkaielgatecl
    npkdydkpiyevicektnggvdyavecagrietmmnalqstycgsgvtvvlglaspnerl
    pldplllltgrslkgsvfggfkgeevsrlvddymkkkinvnflvstkltldqinkafell
    ssgqgvrsimiy