PDB entry 1p0a

View 1p0a on RCSB PDB site
Description: nmr structure of etd135, mutant of the antifungal defensin ard1 from archaeoprepona demophon
Deposited on 2003-04-10, released 2004-03-09
The last revision prior to the SCOP 1.71 freeze date was dated 2004-03-09, with a file datestamp of 2004-03-09.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1p0aa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p0aA (A:)
    dkligscvwgavnytsncnaeckrrgykgghcgsflnvncwcet