PDB entry 1p0a

View 1p0a on RCSB PDB site
Description: NMR structure of ETD135, mutant of the antifungal defensin ARD1 from Archaeoprepona demophon
Class: antifungal protein
Keywords: alpha-beta protein, csab motif (cysteine stabilized alpha-helix beta-sheet motif), antifungal protein
Deposited on 2003-04-10, released 2004-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: defensin ARD1
  Species: Archaeoprepona demophon [TaxId:191427]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P84156 (0-43)
  Domains in SCOPe 2.08: d1p0aa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1p0aA (A:)
  dkligscvwgavnytsncnaeckrrgykgghcgsflnvncwcet