PDB entry 1p09

View 1p09 on RCSB PDB site
Description: structural plasticity as a determinant of enzyme specificity. creating broadly specific proteases
Class: hydrolase (serine proteinase)
Keywords: hydrolase (serine proteinase)
Deposited on 1989-04-24, released 1990-04-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.135
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: alpha-lytic protease
  Species: Lysobacter enzymogenes [TaxId:69]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00778 (Start-197)
    • conflict (157)
  Domains in SCOPe 2.05: d1p09a_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1p09A (A:)
  anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
  gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt
  anyaegavrgltqgnacmgrgdsggswitsagqaqgvasggnvqsngnncgipasqrssl
  ferlqpilsqyglslvtg