PDB entry 1ozv

View 1ozv on RCSB PDB site
Description: Crystal structure of the SET domain of LSMT bound to Lysine and AdoHcy
Class: transferase
Keywords: set domain, lysine n-methylation, multiple methylation, photosynthesis, post-translational modification
Deposited on 2003-04-09, released 2003-07-01
The last revision prior to the SCOP 1.73 freeze date was dated 2003-07-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.227
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplast
    Species: Pisum sativum
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q43088 (Start-437)
      • engineered (438-442)
    Domains in SCOP 1.73: d1ozva1, d1ozva2
  • Chain 'B':
    Compound: Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplast
    Species: Pisum sativum
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q43088 (Start-437)
      • engineered (438-443)
    Domains in SCOP 1.73: d1ozvb1, d1ozvb2
  • Chain 'C':
    Compound: Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplast
    Species: Pisum sativum
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q43088 (Start-437)
      • engineered (438-443)
    Domains in SCOP 1.73: d1ozvc1, d1ozvc2
  • Heterogens: LYS, SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ozvA (A:)
    mtepslspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlw
    inpdavaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseee
    lqelqgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsraf
    srlrnenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvy
    iqydlnksnaelaldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfd
    ifynrtlppgllpylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreac
    ksalagyhttieqdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyy
    qerrlkdlglcgengdilenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ozvA (A:)
    lspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpda
    vaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqelq
    gsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlrn
    enlvvvpmadlinhsagvttedhayevkylfslksplsvkageqvyiqydlnksnaelal
    dygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfdifynrtlppgllpy
    lrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreacksalagyhttieqd
    relkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyyqerrlkdlglcgen
    gdilenlyf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ozvB (B:)
    mtepslspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlw
    inpdavaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseee
    lqelqgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsraf
    srlrnenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvy
    iqydlnksnaelaldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfd
    ifynrtlppgllpylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreac
    ksalagyhttieqdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyy
    qerrlkdlglcgengdilenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ozvB (B:)
    pslspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinp
    davaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqe
    lqgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrl
    rnenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqy
    dlnksnaelaldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfdify
    nrtlppgllpylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreacksa
    lagyhttieqdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyyqer
    rlkdlglcgengdilenlyfq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ozvC (C:)
    mtepslspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlw
    inpdavaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseee
    lqelqgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsraf
    srlrnenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvy
    iqydlnksnaelaldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfd
    ifynrtlppgllpylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreac
    ksalagyhttieqdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyy
    qerrlkdlglcgengdilenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ozvC (C:)
    slspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpd
    avaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqel
    qgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlr
    nenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqyd
    lnksnaelaldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfdifyn
    rtlppgllpylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreacksal
    agyhttieqdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyyqerr
    lkdlglcgengdilenlyfq