PDB entry 1ozs

View 1ozs on RCSB PDB site
Description: C-domain of human cardiac troponin C in complex with the inhibitory region of human cardiac troponin I
Class: structural protein
Keywords: EF-Hand, STRUCTURAL PROTEIN
Deposited on 2003-04-09, released 2003-09-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: Homo sapiens [TaxId:9606]
    Gene: TNNC1 OR TNNC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63316 (1-72)
      • cloning artifact (0)
    Domains in SCOPe 2.03: d1ozsa_
  • Chain 'B':
    Compound: Troponin I, cardiac muscle
    Species: Homo sapiens [TaxId:9606]
    Gene: TNNI3 OR TNNC1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ozsA (A:)
mkgkseeelsdlfrmfdknadgyidleelkimlqatgetiteddieelmkdgdknndgri
dydeflefmkgve

  • Chain 'B':
    No sequence available.