PDB entry 1ozo
View 1ozo on RCSB PDB site
Description: Three-dimensional solution structure of apo-S100P protein determined by NMR spectroscopy
Class: metal binding protein
Keywords: EF-hand, s100 protein, METAL BINDING PROTEIN
Deposited on
2003-04-09, released
2004-04-20
The last revision prior to the SCOPe 2.06 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: S-100P protein
Species: Homo sapiens [TaxId:9606]
Gene: S100P OR S100E
Database cross-references and differences (RAF-indexed):
- Uniprot P25815 (0-94)
- conflict (5)
- conflict (84)
- conflict (91)
Domains in SCOPe 2.06: d1ozoa_ - Chain 'B':
Compound: S-100P protein
Species: Homo sapiens [TaxId:9606]
Gene: S100P OR S100E
Database cross-references and differences (RAF-indexed):
- Uniprot P25815 (0-94)
- conflict (5)
- conflict (84)
- conflict (91)
Domains in SCOPe 2.06: d1ozob_
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1ozoA (A:)
mteleaamgmiidvfsrysgsegstqtltkgelkvlmekelpgflqsgkdkdavdkllkd
ldangdaqvdfsefivfvaaitsashkyfektglk
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1ozoB (B:)
mteleaamgmiidvfsrysgsegstqtltkgelkvlmekelpgflqsgkdkdavdkllkd
ldangdaqvdfsefivfvaaitsashkyfektglk