PDB entry 1ozh

View 1ozh on RCSB PDB site
Description: The crystal structure of Klebsiella pneumoniae acetolactate synthase with enzyme-bound cofactor and with an unusual intermediate.
Class: lyase
Keywords: acetolactate synthase, acetohydroxyacid synthase, thiamin diphosphate, LYASE
Deposited on 2003-04-09, released 2003-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.191
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetolactate synthase, catabolic
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: BUDB OR ILVK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ozha1, d1ozha2, d1ozha3
  • Chain 'B':
    Compound: Acetolactate synthase, catabolic
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: BUDB OR ILVK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ozhb1, d1ozhb2, d1ozhb3, d1ozhb4
  • Chain 'C':
    Compound: Acetolactate synthase, catabolic
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: BUDB OR ILVK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ozhc1, d1ozhc2, d1ozhc3
  • Chain 'D':
    Compound: Acetolactate synthase, catabolic
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: BUDB OR ILVK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ozhd1, d1ozhd2, d1ozhd3
  • Heterogens: PO4, MG, PGE, HE3, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ozhA (A:)
    mdkqypvrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheana
    afmaaavgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkakqvhq
    smdtvamfspvtkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkv
    lpasgapqmgaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvts
    tyqaagavnqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatl
    vhidvlpayeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelld
    rrgaqlnqfalhplrivramqdivnsdvtltvdmgsfhiwiarylytfrarqvmisngqq
    tmgvalpwaigawlvnperkvvsvsgdggflqssmeletavrlkanvlhliwvdngynmv
    aiqeekkyqrlsgvefgpmdfkayaesfgakgfavesaealeptlraamdvdgpavvaip
    vdyrdnpllmgqlhlsqilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ozhA (A:)
    vrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheanaafmaaa
    vgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradksmdtvamfspvt
    kyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkvlpasgapqmgaa
    pddaidqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaagavnqdn
    fsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlpayeer
    nytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelldrgaqlnqfalhp
    lrivramqdivnsdvtltvdmgsfhiwiarylytfrarqvmisngqqtmgvalpwaigaw
    lvnperkvvsvsgdggflqssmeletavrlkanvlhliwvdngynmvaiqeekkyqrlsg
    vefgpmdfkayaesfgakgfavesaealeptlraamdvdgpavvaipvdyrdnpllmgql
    hlsqi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ozhB (B:)
    mdkqypvrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheana
    afmaaavgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkakqvhq
    smdtvamfspvtkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkv
    lpasgapqmgaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvts
    tyqaagavnqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatl
    vhidvlpayeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelld
    rrgaqlnqfalhplrivramqdivnsdvtltvdmgsfhiwiarylytfrarqvmisngqq
    tmgvalpwaigawlvnperkvvsvsgdggflqssmeletavrlkanvlhliwvdngynmv
    aiqeekkyqrlsgvefgpmdfkayaesfgakgfavesaealeptlraamdvdgpavvaip
    vdyrdnpllmgqlhlsqilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ozhB (B:)
    vrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheanaafmaaa
    vgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradsmdtvamfspvtk
    yaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkvlpasgapqmaapd
    daidqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaagavnqdnfs
    rfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlpayeerny
    tpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelldrrgaqlnqfalhpl
    rivramqdivnsdvtltvdmgsfhiwiarylytfrarqvmisngqqtmgvalpwaigawl
    vnperkvvsvsgdggflqssmeletavrlkanvlhliwvdngynmvaiqeekkyqrlsgv
    efgpmdfkayaesfgakgfavesaealeptlraamdvdgpavvaipvdyrdnpllmgqlh
    lsqil
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ozhC (C:)
    mdkqypvrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheana
    afmaaavgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkakqvhq
    smdtvamfspvtkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkv
    lpasgapqmgaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvts
    tyqaagavnqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatl
    vhidvlpayeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelld
    rrgaqlnqfalhplrivramqdivnsdvtltvdmgsfhiwiarylytfrarqvmisngqq
    tmgvalpwaigawlvnperkvvsvsgdggflqssmeletavrlkanvlhliwvdngynmv
    aiqeekkyqrlsgvefgpmdfkayaesfgakgfavesaealeptlraamdvdgpavvaip
    vdyrdnpllmgqlhlsqilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ozhC (C:)
    vrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheanaafmaaa
    vgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkakmdtvamfspv
    tkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkvlpasgamgaap
    ddaidqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaagavnqdnf
    srfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlpayeern
    ytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelldraqlnqfalhplr
    ivramqdivnsdvtltvdmgsfhiwiarylytfrarqvmisngqqtmgvalpwaigawlv
    nperkvvsvsgdggflqssmeletavrlkanvlhliwvdngynmvaiqeekkyqrlsgve
    fgpmdfkayaesfgakgfavesaealeptlraamdvdgpavvaipvdyrdnpllmgqlhl
    sqi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ozhD (D:)
    mdkqypvrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheana
    afmaaavgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkakqvhq
    smdtvamfspvtkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkv
    lpasgapqmgaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvts
    tyqaagavnqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatl
    vhidvlpayeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelld
    rrgaqlnqfalhplrivramqdivnsdvtltvdmgsfhiwiarylytfrarqvmisngqq
    tmgvalpwaigawlvnperkvvsvsgdggflqssmeletavrlkanvlhliwvdngynmv
    aiqeekkyqrlsgvefgpmdfkayaesfgakgfavesaealeptlraamdvdgpavvaip
    vdyrdnpllmgqlhlsqilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ozhD (D:)
    vrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheanaafmaaa
    vgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradksmdtvamfspvt
    kyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkvlpasgapqmgaa
    pddaidqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaagavnqdn
    fsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlpayeer
    nytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelldlnqfalhplriv
    ramqdivnsdvtltvdmgsfhiwiarylytfrarqvmisngqqtmgvalpwaigawlvnp
    erkvvsvsgdggflqssmeletavrlkanvlhliwvdngynmvaiqeekkyqrlsgvefg
    pmdfkayaesfgakgfavesaealeptlraamdvdgpavvaipvdyrdnpllmgqlhl