PDB entry 1ozf

View 1ozf on RCSB PDB site
Description: The crystal structure of Klebsiella pneumoniae acetolactate synthase with enzyme-bound cofactors
Deposited on 2003-04-09, released 2003-11-11
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-27, with a file datestamp of 2004-01-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.165
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ozfA (A:)
    mdkqypvrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheana
    afmaaavgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkakqvhq
    smdtvamfspvtkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkv
    lpasgapqmgaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvts
    tyqaagavnqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatl
    vhidvlpayeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelld
    rrgaqlnqfalhplrivramqdivnsdvtltvdmgsfhiwiarylytfrarqvmisngqq
    tmgvalpwaigawlvnperkvvsvsgdggflqssmeletavrlkanvlhliwvdngynmv
    aiqeekkyqrlsgvefgpmdfkayaesfgakgfavesaealeptlraamdvdgpavvaip
    vdyrdnpllmgqlhlsqilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ozfA (A:)
    vrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheanaafmaaa
    vgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkakqvhqsmdtva
    mfspvtkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkvlpapqm
    gaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaagavn
    qdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlpay
    eernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelldrrgaqlnqf
    alhplrivramqdivnsdvtltvdmgsfhiwiarylytfrarqvmisngqqtmgvalpwa
    igawlvnperkvvsvsgdggflqssmeletavrlkanvlhliwvdngynmvaiqeekkyq
    rlsgvefgpmdfkayaesfgakgfavesaealeptlraamdvdgpavvaipvdyrdnpll
    mgqlh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ozfB (B:)
    mdkqypvrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheana
    afmaaavgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkakqvhq
    smdtvamfspvtkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkv
    lpasgapqmgaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvts
    tyqaagavnqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatl
    vhidvlpayeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelld
    rrgaqlnqfalhplrivramqdivnsdvtltvdmgsfhiwiarylytfrarqvmisngqq
    tmgvalpwaigawlvnperkvvsvsgdggflqssmeletavrlkanvlhliwvdngynmv
    aiqeekkyqrlsgvefgpmdfkayaesfgakgfavesaealeptlraamdvdgpavvaip
    vdyrdnpllmgqlhlsqilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ozfB (B:)
    ypvrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheanaafma
    aavgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkakqsmdtvam
    fspvtkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkvlpapqmg
    aapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaagavnq
    dnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlpaye
    ernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelldraqlnqfalh
    plrivramqdivnsdvtltvdmgsfhiwiarylytfrarqvmisngqqtmgvalpwaiga
    wlvnperkvvsvsgdggflqssmeletavrlkanvlhliwvdngynmvaiqeekkyqrls
    gvefgpmdfkayaesfgakgfavesaealeptlraamdvdgpavvaipvdyrdnpllmgq
    lh