PDB entry 1ozf

View 1ozf on RCSB PDB site
Description: The crystal structure of Klebsiella pneumoniae acetolactate synthase with enzyme-bound cofactors
Class: lyase
Keywords: acetolactate synthase, acetohydroxyacid synthase, thiamin diphosphate, LYASE
Deposited on 2003-04-09, released 2003-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.165
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetolactate synthase, catabolic
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: BUDB OR ILVK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ozfa1, d1ozfa2, d1ozfa3
  • Chain 'B':
    Compound: Acetolactate synthase, catabolic
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: BUDB OR ILVK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ozfb1, d1ozfb2, d1ozfb3
  • Heterogens: PO4, MG, TPP, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ozfA (A:)
    mdkqypvrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheana
    afmaaavgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkakqvhq
    smdtvamfspvtkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkv
    lpasgapqmgaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvts
    tyqaagavnqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatl
    vhidvlpayeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelld
    rrgaqlnqfalhplrivramqdivnsdvtltvdmgsfhiwiarylytfrarqvmisngqq
    tmgvalpwaigawlvnperkvvsvsgdggflqssmeletavrlkanvlhliwvdngynmv
    aiqeekkyqrlsgvefgpmdfkayaesfgakgfavesaealeptlraamdvdgpavvaip
    vdyrdnpllmgqlhlsqilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ozfA (A:)
    vrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheanaafmaaa
    vgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkakqvhqsmdtva
    mfspvtkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkvlpapqm
    gaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaagavn
    qdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlpay
    eernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelldrrgaqlnqf
    alhplrivramqdivnsdvtltvdmgsfhiwiarylytfrarqvmisngqqtmgvalpwa
    igawlvnperkvvsvsgdggflqssmeletavrlkanvlhliwvdngynmvaiqeekkyq
    rlsgvefgpmdfkayaesfgakgfavesaealeptlraamdvdgpavvaipvdyrdnpll
    mgqlh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ozfB (B:)
    mdkqypvrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheana
    afmaaavgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkakqvhq
    smdtvamfspvtkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkv
    lpasgapqmgaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvts
    tyqaagavnqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatl
    vhidvlpayeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelld
    rrgaqlnqfalhplrivramqdivnsdvtltvdmgsfhiwiarylytfrarqvmisngqq
    tmgvalpwaigawlvnperkvvsvsgdggflqssmeletavrlkanvlhliwvdngynmv
    aiqeekkyqrlsgvefgpmdfkayaesfgakgfavesaealeptlraamdvdgpavvaip
    vdyrdnpllmgqlhlsqilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ozfB (B:)
    ypvrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheanaafma
    aavgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkakqsmdtvam
    fspvtkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkvlpapqmg
    aapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaagavnq
    dnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlpaye
    ernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelldraqlnqfalh
    plrivramqdivnsdvtltvdmgsfhiwiarylytfrarqvmisngqqtmgvalpwaiga
    wlvnperkvvsvsgdggflqssmeletavrlkanvlhliwvdngynmvaiqeekkyqrls
    gvefgpmdfkayaesfgakgfavesaealeptlraamdvdgpavvaipvdyrdnpllmgq
    lh