PDB entry 1oza

View 1oza on RCSB PDB site
Description: Crystal Structure of the R103L Mutant of Aspartate Semialdehyde Dehydrogenase from Haemophilus influenzae
Deposited on 2003-04-08, released 2004-06-08
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-17, with a file datestamp of 2004-08-17.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.208
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ozaA (A:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqagqkapvfggkdagdlksafd
    ieelkkldiivtcqggdytnevypklkatgwdgywvdaasallmkddaiivldpvnqhvi
    seglkkgiktfvggnctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqm
    glleqavsselkdpassildierkvtakmradnfptdnfgaalggslipwidkllpetgq
    tkeewkgyaetnkilglsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiias
    hnewvkvipndkeitlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaae
    pvrrilkqlva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ozaA (A:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqalksafdieelkkldiivtcq
    ggdytnevypklkatgwdgywvdaasallmkddaiivldpvnqhviseglkkgiktfvgg
    nctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqmglleqavsselkdp
    assildierkvtakmradnfptdnfgaalggslipwidkllpetgqtkeewkgyaetnki
    lglsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiiashnewvkvipndkei
    tlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaaepvrrilkqlva