PDB entry 1oz9

View 1oz9 on RCSB PDB site
Description: Crystal structure of AQ_1354, a hypothetical protein from Aquifex aeolicus
Class: unknown function
Keywords: matrix metalloproteinase type fold, Structural Genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, UNKNOWN FUNCTION
Deposited on 2003-04-08, released 2003-09-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.207
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein AQ_1354
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1oz9a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oz9A (A:)
    msstkrqknrvlvklkkrkvrkdkiekwaelalsalglnnvelsvyitddqeirelnkty
    rkkdkptdvlsfpmgeefggykilgdvvisqdtaerqarelghsleeevkrlivhgivhl
    lgydhekggeeekkfrelenyvlsklskal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oz9A (A:)
    knrvlvklkkrkvrkdkiekwaelalsalglnnvelsvyitddqeirelnktyrkkdkpt
    dvlsfpmgeefggykilgdvvisqdtaerqarelghsleeevkrlivhgivhllgydhek
    ggeeekkfrelenyvlsklsk