PDB entry 1oz7

View 1oz7 on RCSB PDB site
Description: Crystal structure of Echicetin from the venom of Indian saw-scaled viper (Echis carinatus) at 2.4 resolution
Class: toxin
Keywords: platelet aggregation, echicetin, dimer, toxin
Deposited on 2003-04-08, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.188
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: echicetin A-chain
    Species: Echis carinatus [TaxId:40353]
    Database cross-references and differences (RAF-indexed):
    • GB AAP41218 (0-130)
    Domains in SCOPe 2.07: d1oz7a_
  • Chain 'B':
    Compound: echicetin B-chain
    Species: Echis carinatus [TaxId:40353]
    Database cross-references and differences (RAF-indexed):
    • GB AAP41219 (0-122)
    Domains in SCOPe 2.07: d1oz7b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1oz7A (A:)
mcppgwssngvycymlfkepktwdeaekfcnkqgkdghllsieskkeeilvdivvsenig
kmykiwtglserskeqhcssrwsdgsffrsyeiairysecfvlekqsvfrtwvatpcent
fpfmckypvpr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1oz7B (B:)
nclpdwsvyegycykvfkermnwadaekfctkqhkdghlvsfrnskevdfvislafpmlk
ndlvwigltdywrdcnwewsdgaqldykawdnerhcfiykntdnqwtrrdctwtfsfvck
cpa