PDB entry 1oz6

View 1oz6 on RCSB PDB site
Description: X-ray structure of acidic phospholipase A2 from Indian saw-scaled viper (Echis carinatus) with a potent platelet aggregation inhibitory activity
Deposited on 2003-04-08, released 2003-12-30
The last revision prior to the SCOP 1.69 freeze date was dated 2003-12-30, with a file datestamp of 2003-12-30.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.207
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1oz6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oz6A (A:)
    nlyqfgrmiwnrtgklpilsygsygcycgwggqgppkdatdrcclvhdccytrvgdcspk
    mtlysyrfengdiicdnkdpckravcecdreaaiclgenvntydkkyksyedcteevqec