PDB entry 1oz6

View 1oz6 on RCSB PDB site
Description: X-ray structure of acidic phospholipase A2 from Indian saw-scaled viper (Echis carinatus) with a potent platelet aggregation inhibitory activity
Class: hydrolase
Keywords: enzyme, PLA2, hydrolase
Deposited on 2003-04-08, released 2003-12-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.207
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Echis carinatus [TaxId:40353]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7T3S7 (0-119)
  Domains in SCOPe 2.08: d1oz6a_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1oz6A (A:)
  nlyqfgrmiwnrtgklpilsygsygcycgwggqgppkdatdrcclvhdccytrvgdcspk
  mtlysyrfengdiicdnkdpckravcecdreaaiclgenvntydkkyksyedcteevqec