PDB entry 1oz3

View 1oz3 on RCSB PDB site
Description: Crystal Structure of 3-MBT repeats of lethal (3) malignant Brain Tumor (Native-I) at 1.85 angstrom
Class: transcription
Keywords: Propeller, three malignant brain tumor, TRANSCRIPTION
Deposited on 2003-04-07, released 2003-08-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.213
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lethal(3)malignant brain tumor-like protein
    Species: Homo sapiens [TaxId:9606]
    Gene: L3MBTL OR L3MBT OR KIAA0681
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1oz3a1, d1oz3a2, d1oz3a3
  • Chain 'B':
    Compound: Lethal(3)malignant brain tumor-like protein
    Species: Homo sapiens [TaxId:9606]
    Gene: L3MBTL OR L3MBT OR KIAA0681
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1oz3b1, d1oz3b2, d1oz3b3
  • Chain 'C':
    Compound: Lethal(3)malignant brain tumor-like protein
    Species: Homo sapiens [TaxId:9606]
    Gene: L3MBTL OR L3MBT OR KIAA0681
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1oz3c1, d1oz3c2, d1oz3c3
  • Heterogens: SO4, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oz3A (A:)
    patgekkecwswesyleeqkaitapvslfqdsqavthnkngfklgmklegidpqhpsmyf
    iltvaevcgyrlrlhfdgysechdfwvnanspdihpagwfektghklqppkgykeeefsw
    sqylrstraqaapkhlfvsqshsppplgfqvgmkleavdrmnpslvcvasvtdvvdsrfl
    vhfdnwddtydywcdpsspyihpvgwcqkqgkpltppqdypdpdnfcwekyleetgasav
    ptwafkvrpphsflvnmkleavdrrnpalirvasvedvedhrikihfdgwshgydfwida
    dhpdihpagwcsktghplqpplgprepssas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oz3A (A:)
    wswesyleeqkaitapvslfqdsqavthnkngfklgmklegidpqhpsmyfiltvaevcg
    yrlrlhfdgysechdfwvnanspdihpagwfektghklqppkgykeeefswsqylrstra
    qaapkhlfvsqshsppplgfqvgmkleavdrmnpslvcvasvtdvvdsrflvhfdnwddt
    ydywcdpsspyihpvgwcqkqgkpltppqdypdpdnfcwekyleetgasavptwafkvrp
    phsflvnmkleavdrrnpalirvasvedvedhrikihfdgwshgydfwidadhpdihpag
    wcsktghplqppl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oz3B (B:)
    patgekkecwswesyleeqkaitapvslfqdsqavthnkngfklgmklegidpqhpsmyf
    iltvaevcgyrlrlhfdgysechdfwvnanspdihpagwfektghklqppkgykeeefsw
    sqylrstraqaapkhlfvsqshsppplgfqvgmkleavdrmnpslvcvasvtdvvdsrfl
    vhfdnwddtydywcdpsspyihpvgwcqkqgkpltppqdypdpdnfcwekyleetgasav
    ptwafkvrpphsflvnmkleavdrrnpalirvasvedvedhrikihfdgwshgydfwida
    dhpdihpagwcsktghplqpplgprepssas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oz3B (B:)
    wswesyleeqkaitapvslfqdsqavthnkngfklgmklegidpqhpsmyfiltvaevcg
    yrlrlhfdgysechdfwvnanspdihpagwfektghklqppkgykeeefswsqylrstra
    qaapkhlfvsqshsppplgfqvgmkleavdrmnpslvcvasvtdvvdsrflvhfdnwddt
    ydywcdpsspyihpvgwcqkqgkpltppqdypdpdnfcwekyleetgasavptwafkvrp
    phsflvnmkleavdrrnpalirvasvedvedhrikihfdgwshgydfwidadhpdihpag
    wcsktghplqppl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1oz3C (C:)
    patgekkecwswesyleeqkaitapvslfqdsqavthnkngfklgmklegidpqhpsmyf
    iltvaevcgyrlrlhfdgysechdfwvnanspdihpagwfektghklqppkgykeeefsw
    sqylrstraqaapkhlfvsqshsppplgfqvgmkleavdrmnpslvcvasvtdvvdsrfl
    vhfdnwddtydywcdpsspyihpvgwcqkqgkpltppqdypdpdnfcwekyleetgasav
    ptwafkvrpphsflvnmkleavdrrnpalirvasvedvedhrikihfdgwshgydfwida
    dhpdihpagwcsktghplqpplgprepssas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oz3C (C:)
    wswesyleeqkaitapvslfqdsqavthnkngfklgmklegidpqhpsmyfiltvaevcg
    yrlrlhfdgysechdfwvnanspdihpagwfektghklqppkgykeeefswsqylrstra
    qaapkhlfvsqshsppplgfqvgmkleavdrmnpslvcvasvtdvvdsrflvhfdnwddt
    ydywcdpsspyihpvgwcqkqgkpltppqdypdpdnfcwekyleetgasavptwafkvrp
    phsflvnmkleavdrrnpalirvasvedvedhrikihfdgwshgydfwidadhpdihpag
    wcsktghplqppl