PDB entry 1oz1

View 1oz1 on RCSB PDB site
Description: p38 mitogen-activated kinase in complex with 4-azaindole inhibitor
Class: transferase
Keywords: ser/thr protein kinase, transferase
Deposited on 2003-04-07, released 2003-09-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.204
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14 OR CSBP1 OR CSBP2 OR CSBP OR MXI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1oz1a_
  • Heterogens: FPH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oz1A (A:)
    mgrshhhhhhgsmsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktgl
    rvavkklsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthl
    mgadlnnivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkild
    fglarhtddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdh
    idqlklilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekm
    lvldsdkritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisf
    vpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oz1A (A:)
    rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivltddhvq
    fliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyvatrwy
    rapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellk
    kissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayf
    aqyhdpddepvadpydqsfesrdllidewksltydevisfvppp