PDB entry 1oyy

View 1oyy on RCSB PDB site
Description: structure of the recq catalytic core bound to atp-gamma-s
Deposited on 2003-04-07, released 2003-10-07
The last revision prior to the SCOP 1.67 freeze date was dated 2003-10-07, with a file datestamp of 2003-10-07.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.23
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oyyA (A:)
    maqaevlnlesgakqvlqetfgyqqfrpgqeeiidtvlsgrdclvvmptgggkslcyqip
    alllngltvvvsplislmkdqvdqlqangvaaaclnstqtreqqlevmtgcrtgqirlly
    iaperlmldnflehlahwnpvllavdeahcisqwghdfrpeyaalgqlrqrfptlpfmal
    tataddttrqdivrllglndpliqissfdrpnirymlmekfkpldqlmryvqeqrgksgi
    iycnsrakvedtaarlqskgisaaayhaglennvradvqekfqrddlqivvatvafgmgi
    nkpnvrfvvhfdiprniesyyqetgragrdglpaeamlfydpadmawlrrcleekpqgql
    qdierhklnamgafaeaqtcrrlvllnyfgegrqepcgncdicldppkqydgstdaqial
    stigrvnqrfgmgyvvevirgannqrirdyghdklkvygmgrdkshehwvsvirqlihlg
    lvtqniaqhsalqlteaarpvlrgesslqlavprivalkpkam
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oyyA (A:)
    maqaevlnlesgakqvlqetfgyqqfrpgqeeiidtvlsgrdclvvmptgggkslcyqip
    alllngltvvvsplislmkdqvdqlqangvaaaclnstqtreqqlevmtgcrtgqirlly
    iaperlmldnflehlahwnpvllavdeahcisqwghdfrpeyaalgqlrqrfptlpfmal
    tataddttrqdivrllglndpliqissfdrpnirymlmekfkpldqlmryvqeqrgksgi
    iycnsrakvedtaarlqskgisaaayhaglennvradvqekfqrddlqivvatvainkpn
    vrfvvhfdiprniesyyqetgragrdglpaeamlfydpadmawlrrcleekpqgqlqdie
    rhklnamgafaeaqtcrrlvllnyfgegrqepcgncdicldppkqydgstdaqialstig
    rvnqrfgmgyvvevirgannqrirdyghdklkvygmgrdkshehwvsvirqlihlglvtq
    niaqhsalqlteaarpvlrgesslqlavpriv