PDB entry 1oyy

View 1oyy on RCSB PDB site
Description: Structure of the RecQ Catalytic Core bound to ATP-gamma-S
Class: hydrolase
Keywords: RecQ, helicase, winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, ATP(gamma)S, HYDROLASE
Deposited on 2003-04-07, released 2003-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.23
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent DNA helicase
    Species: Escherichia coli [TaxId:562]
    Gene: recQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15043 (1-End)
      • initiating met (0)
    Domains in SCOPe 2.07: d1oyya1, d1oyya2, d1oyya3
  • Heterogens: ZN, MN, AGS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oyyA (A:)
    maqaevlnlesgakqvlqetfgyqqfrpgqeeiidtvlsgrdclvvmptgggkslcyqip
    alllngltvvvsplislmkdqvdqlqangvaaaclnstqtreqqlevmtgcrtgqirlly
    iaperlmldnflehlahwnpvllavdeahcisqwghdfrpeyaalgqlrqrfptlpfmal
    tataddttrqdivrllglndpliqissfdrpnirymlmekfkpldqlmryvqeqrgksgi
    iycnsrakvedtaarlqskgisaaayhaglennvradvqekfqrddlqivvatvafgmgi
    nkpnvrfvvhfdiprniesyyqetgragrdglpaeamlfydpadmawlrrcleekpqgql
    qdierhklnamgafaeaqtcrrlvllnyfgegrqepcgncdicldppkqydgstdaqial
    stigrvnqrfgmgyvvevirgannqrirdyghdklkvygmgrdkshehwvsvirqlihlg
    lvtqniaqhsalqlteaarpvlrgesslqlavprivalkpkam
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oyyA (A:)
    maqaevlnlesgakqvlqetfgyqqfrpgqeeiidtvlsgrdclvvmptgggkslcyqip
    alllngltvvvsplislmkdqvdqlqangvaaaclnstqtreqqlevmtgcrtgqirlly
    iaperlmldnflehlahwnpvllavdeahcisqwghdfrpeyaalgqlrqrfptlpfmal
    tataddttrqdivrllglndpliqissfdrpnirymlmekfkpldqlmryvqeqrgksgi
    iycnsrakvedtaarlqskgisaaayhaglennvradvqekfqrddlqivvatvainkpn
    vrfvvhfdiprniesyyqetgragrdglpaeamlfydpadmawlrrcleekpqgqlqdie
    rhklnamgafaeaqtcrrlvllnyfgegrqepcgncdicldppkqydgstdaqialstig
    rvnqrfgmgyvvevirgannqrirdyghdklkvygmgrdkshehwvsvirqlihlglvtq
    niaqhsalqlteaarpvlrgesslqlavpriv