PDB entry 1oym

View 1oym on RCSB PDB site
Description: Crystal structure of PDE4D2 in complex with (R)-rolipram
Class: hydrolase
Keywords: cyclic nucleotide, cAMP, PDE selective inhibitors, rolipram
Deposited on 2003-04-05, released 2003-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2003-09-02, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.224
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific phosphodiesterase PDE4D2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • GB AAC00070 (0-End)
    Domains in SCOPe 2.07: d1oyma_
  • Chain 'B':
    Compound: cAMP-specific phosphodiesterase PDE4D2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • GB AAC00070
    Domains in SCOPe 2.07: d1oymb_
  • Chain 'C':
    Compound: cAMP-specific phosphodiesterase PDE4D2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • GB AAC00070
  • Chain 'D':
    Compound: cAMP-specific phosphodiesterase PDE4D2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • GB AAC00070 (0-End)
  • Heterogens: ZN, ROL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oymA (A:)
    iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
    vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
    ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
    slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
    lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
    plwetwadlvhpdaqdildtlednrewyqstipqspspapddpeegrqgqtekfqfeltl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oymA (A:)
    iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
    vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
    ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
    slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
    lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
    plwetwadlvhpdaqdildtlednrewyqstipq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oymB (B:)
    iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
    vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
    ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
    slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
    lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
    plwetwadlvhpdaqdildtlednrewyqstipqspspapddpeegrqgqtekfqfeltl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oymB (B:)
    teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
    lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
    gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
    divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
    lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
    dlvhpdaqdildtlednrewyqstipq
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.