PDB entry 1oyi

View 1oyi on RCSB PDB site
Description: Solution structure of the Z-DNA binding domain of the vaccinia virus gene E3L
Class: Viral protein
Keywords: (alpha+beta) helix-turn-helix, Viral protein
Deposited on 2003-04-04, released 2004-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: double-stranded RNA-binding protein
    Species: Vaccinia virus [TaxId:10245]
    Gene: E3L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1oyia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1oyiA (A:)
gshmaskiyidersnaeivceaiktigiegataaqltrqlnmekrevnkalydlqrsamv
yssddipprwfmtteadeadad

    Sequence, based on observed residues (ATOM records): (download) 
    >1oyiA (A:)
rsnaeivceaiktigiegataaqltrqlnmekrevnkalydlqrsamvyssddipprwfm
tt