PDB entry 1oyg

View 1oyg on RCSB PDB site
Description: Crystal structure of Bacillus subtilis levansucrase
Class: transferase
Keywords: glycoside hydrolase, levansucrase, beta-propeller, levan, TRANSFERASE
Deposited on 2003-04-04, released 2003-10-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.166
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Levansucrase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: sacB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1oyga_
  • Heterogens: CA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oygA (A:)
    asmketnqkpyketygishitrhdmlqipeqqknekyqvpefdsstiknissakgldvwd
    swplqnadgtvanyhgyhivfalagdpknaddtsiymfyqkvgetsidswknagrvfkds
    dkfdandsilkdqtqewsgsatftsdgkirlfytdfsgkhygkqtlttaqvnvsasdssl
    ningvedyksifdgdgktyqnvqqfidegnyssgdnhtlrdphyvedkghkylvfeantg
    tedgyqgeeslfnkayygkstsffrqesqkllqsdkkrtaelangalgmielnddytlkk
    vmkpliasntvtdeieranvfkmngkwylftdsrgskmtidgitsndiymlgyvsnsltg
    pykplnktglvlkmdldpndvtftyshfavpqakgnnvvitsymtnrgfyadkqstfaps
    fllnikgkktsvvkdsileqgqltvnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oygA (A:)
    qkpyketygishitrhdmlqipeqqknekyqvpefdsstiknissakgldvwdswplqna
    dgtvanyhgyhivfalagdpknaddtsiymfyqkvgetsidswknagrvfkdsdkfdand
    silkdqtqewsgsatftsdgkirlfytdfsgkhygkqtlttaqvnvsasdsslningved
    yksifdgdgktyqnvqqfidegnyssgdnhtlrdphyvedkghkylvfeantgtedgyqg
    eeslfnkayygkstsffrqesqkllqsdkkrtaelangalgmielnddytlkkvmkplia
    sntvtdeieranvfkmngkwylftdsrgskmtidgitsndiymlgyvsnsltgpykplnk
    tglvlkmdldpndvtftyshfavpqakgnnvvitsymtnrgfyadkqstfapsfllnikg
    kktsvvkdsileqgqltvnk