PDB entry 1oy2

View 1oy2 on RCSB PDB site
Description: Coupling of Folding and Binding in the PTB Domain of the Signaling Protein Shc
Class: Signaling protein
Keywords: Free Protein, Structure Disorder, Beta Sandwich
Deposited on 2003-04-03, released 2004-04-06
The last revision prior to the SCOP 1.75 freeze date was dated 2004-04-06, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SHC Transforming protein
    Species: HOMO SAPIENS
    Gene: Shc
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1oy2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oy2A (A:)
    mnklsggggrrtrveggqlggeewtrhgsfvnkptrgwlhpndkvmgpgvsylvrymgcv
    evlqsmraldfntrtqvtreaislvceavpgakgatrrrkpcsrplssilgrsnlkfagm
    pitltvstsslnlmaadckqiianhhmqsisfasggdpdtaeyvayvakdpvnqrachil
    ecpeglaqdvistigqafelrfkqylr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oy2A (A:)
    gqlggeewtrhgsfvnkptrgwlhpndkvmgpgvsylvrymgcvevlqsmraldfntrtq
    vtreaislvceavpgakgatrrrkpcsrplssilgrsnlkfagmpitltvstsslnlmaa
    dckqiianhhmqsisfasggdpdtaeyvayvakdpvnqrachilecpeglaqdvistigq
    afelrfkqylr