PDB entry 1oxr

View 1oxr on RCSB PDB site
Description: aspirin induces its anti-inflammatory effects through its specific binding to phospholipase a2: crystal structure of the complex formed between phospholipase a2 and aspirin at 1.9a resolution
Deposited on 2003-04-03, released 2004-04-27
The last revision prior to the SCOP 1.69 freeze date was dated 2004-04-27, with a file datestamp of 2004-04-27.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.177
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1oxra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oxrA (A:)
    nlyqfknmiqctvpsrswqdfadygcycgkggsgtpvddldrccqvhdncyneaenisgc
    rpyfktysyectqgtltckgdnnacaasvcdcdrlaaicfagapyndanynidlkarcn