PDB entry 1oxl

View 1oxl on RCSB PDB site
Description: inhibition of phospholipase a2 (pla2) by (2-carbamoylmethyl-5-propyl-octahydro-indol-7-yl)-acetic acid (indole): crystal structure of the complex formed between pla2 from russell's viper and indole at 1.8 resolution
Class: hydrolase
Keywords: phospholipase A2, indole derivative, inhibition, HYDROLASE
Deposited on 2003-04-02, released 2004-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 VRV-PL-VIIIa
    Species: Daboia russellii russellii [TaxId:31159]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oxla_
  • Chain 'B':
    Compound: Phospholipase A2 VRV-PL-VIIIa
    Species: Daboia russellii russellii [TaxId:31159]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oxlb_
  • Heterogens: IDA, CO3, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oxlA (A:)
    sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
    sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
    c
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oxlB (B:)
    sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
    sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
    c