PDB entry 1oxk

View 1oxk on RCSB PDB site
Description: Complex between YPD1 and SLN1 response regulator domain in space group P3(2)
Deposited on 2003-04-02, released 2003-12-16
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-16, with a file datestamp of 2003-12-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.237
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1oxka_
  • Chain 'B':
    Domains in SCOP 1.67: d1oxkb_
  • Chain 'C':
    Domains in SCOP 1.67: d1oxkc_
  • Chain 'D':
    Domains in SCOP 1.67: d1oxkd_
  • Chain 'E':
    Domains in SCOP 1.67: d1oxke_
  • Chain 'F':
    Domains in SCOP 1.67: d1oxkf_
  • Chain 'G':
    Domains in SCOP 1.67: d1oxkg_
  • Chain 'H':
    Domains in SCOP 1.67: d1oxkh_
  • Chain 'I':
    Domains in SCOP 1.67: d1oxki_
  • Chain 'J':
    Domains in SCOP 1.67: d1oxkj_
  • Chain 'K':
    Domains in SCOP 1.67: d1oxkk_
  • Chain 'L':
    Domains in SCOP 1.67: d1oxkl_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oxkA (A:)
    stipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteldn
    lghflkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginidedd
    eeikiqvddkdensiyliliakalnqsrlefklarielskyyntnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oxkA (A:)
    stipseiinwtilneiismddfskgliiqfidqaqttfaqmqrqldgeknlteldnlghf
    lkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginideddeeik
    densiyliliakalnqsrlefklarielskyyntnl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oxkB (B:)
    svkilvvednhvnqevikrmlnlegienielacdgqeafdkvkeltskgenynmifmdvq
    mpkvdgllstkmirrdlgytspivaltafaddsnikeclesgmngflskpikrpklktil
    tefcaayqgkknnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oxkB (B:)
    svkilvvednhvnqevikrmlnlegienielacdgqeafdkvkeltskgenynmifmdvq
    mpkvdgllstkmirrdlgytspivaltafaddsnikeclesgmngflskpikrpklktil
    tefcaayq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1oxkC (C:)
    stipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteldn
    lghflkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginidedd
    eeikiqvddkdensiyliliakalnqsrlefklarielskyyntnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oxkC (C:)
    stipseiinwtilneiismddfskgliiqfidqaqttfaqmqrqldgeknlteldnlghf
    lkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginideddeeik
    densiyliliakalnqsrlefklarielskyyntnl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1oxkD (D:)
    svkilvvednhvnqevikrmlnlegienielacdgqeafdkvkeltskgenynmifmdvq
    mpkvdgllstkmirrdlgytspivaltafaddsnikeclesgmngflskpikrpklktil
    tefcaayqgkknnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oxkD (D:)
    svkilvvednhvnqevikrmlnlegienielacdgqeafdkvkeltskgenynmifmdvq
    mpkvdgllstkmirrdlgytspivaltafaddsnikeclesgmngflskpikrpklktil
    tefcaayq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1oxkE (E:)
    stipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteldn
    lghflkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginidedd
    eeikiqvddkdensiyliliakalnqsrlefklarielskyyntnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oxkE (E:)
    stipseiinwtilneiismddfskgliiqfidqaqttfaqmqrqldgeknlteldnlghf
    lkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginideddeeik
    densiyliliakalnqsrlefklarielskyyntnl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1oxkF (F:)
    svkilvvednhvnqevikrmlnlegienielacdgqeafdkvkeltskgenynmifmdvq
    mpkvdgllstkmirrdlgytspivaltafaddsnikeclesgmngflskpikrpklktil
    tefcaayqgkknnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oxkF (F:)
    svkilvvednhvnqevikrmlnlegienielacdgqeafdkvkeltskgenynmifmdvq
    mpkvdgllstkmirrdlgytspivaltafaddsnikeclesgmngflskpikrpklktil
    tefcaayq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1oxkG (G:)
    stipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteldn
    lghflkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginidedd
    eeikiqvddkdensiyliliakalnqsrlefklarielskyyntnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oxkG (G:)
    stipseiinwtilneiismddfskgliiqfidqaqttfaqmqrqldgeknlteldnlghf
    lkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginideddeeik
    densiyliliakalnqsrlefklarielskyyntnl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1oxkH (H:)
    svkilvvednhvnqevikrmlnlegienielacdgqeafdkvkeltskgenynmifmdvq
    mpkvdgllstkmirrdlgytspivaltafaddsnikeclesgmngflskpikrpklktil
    tefcaayqgkknnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oxkH (H:)
    svkilvvednhvnqevikrmlnlegienielacdgqeafdkvkeltskgenynmifmdvq
    mpkvdgllstkmirrdlgytspivaltafaddsnikeclesgmngflskpikrpklktil
    tefcaayq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1oxkI (I:)
    stipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteldn
    lghflkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginidedd
    eeikiqvddkdensiyliliakalnqsrlefklarielskyyntnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oxkI (I:)
    stipseiinwtilneiismddfskgliiqfidqaqttfaqmqrqldgeknlteldnlghf
    lkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginideddeeik
    densiyliliakalnqsrlefklarielskyyntnl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1oxkJ (J:)
    svkilvvednhvnqevikrmlnlegienielacdgqeafdkvkeltskgenynmifmdvq
    mpkvdgllstkmirrdlgytspivaltafaddsnikeclesgmngflskpikrpklktil
    tefcaayqgkknnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oxkJ (J:)
    svkilvvednhvnqevikrmlnlegienielacdgqeafdkvkeltskgenynmifmdvq
    mpkvdgllstkmirrdlgytspivaltafaddsnikeclesgmngflskpikrpklktil
    tefcaayq
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1oxkK (K:)
    stipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteldn
    lghflkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginidedd
    eeikiqvddkdensiyliliakalnqsrlefklarielskyyntnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oxkK (K:)
    stipseiinwtilneiismddfskgliiqfidqaqttfaqmqrqldgeknlteldnlghf
    lkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginideddeeik
    densiyliliakalnqsrlefklarielskyyntnl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1oxkL (L:)
    svkilvvednhvnqevikrmlnlegienielacdgqeafdkvkeltskgenynmifmdvq
    mpkvdgllstkmirrdlgytspivaltafaddsnikeclesgmngflskpikrpklktil
    tefcaayqgkknnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oxkL (L:)
    svkilvvednhvnqevikrmlnlegienielacdgqeafdkvkeltskgenynmifmdvq
    mpkvdgllstkmirrdlgytspivaltafaddsnikeclesgmngflskpikrpklktil
    tefcaayq