PDB entry 1oxh

View 1oxh on RCSB PDB site
Description: the crystal structure of beta-ketoacyl-[acyl carrier protein] synthase ii from streptococcus pneumoniae, triclinic form
Deposited on 2003-04-02, released 2003-04-22
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-15, with a file datestamp of 2003-07-15.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.209
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oxhA (A:)
    gsshhhhhhssglvprgshmklnrvvvtgygvtspigntpeefwnslatgkigiggitkf
    dhsdfdvhnaaeiqdfpfdkyfvkkdtnrfdnyslyalyaaqeavnhanldvealnrdrf
    gvivasgiggikeiedqvlrlhekgpkrvkpmtlpkalpnmasgnvamrfgangvcksin
    tacsssndaigdafrsikfgfqdvmlvggteasitpfaiagfqaltalsttedptrasip
    fdkdrngfvmgegsgmlvleslehaekrgatilaevvgygntcdayhmtsphpegqgaik
    aiklaleeaeispeqvayvnahgtstpanekgesgaivavlgkevpvsstksftghllga
    agaveaivtieamrhnfvpmtagtsevsdyieanvvygqglekeipyaisntfgfgghna
    vlafkrwenr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oxhA (A:)
    klnrvvvtgygvtspigntpeefwnslatgkigiggitkfdhsdfdvhnaaeiqdfpfdk
    yfvkkdtnrfdnyslyalyaaqeavnhanldvealnrdrfgvivasgiggikeiedqvlr
    lhekgpkrvkpmtlpkalpnmasgnvamrfgangvcksintacsssndaigdafrsikfg
    fqdvmlvggteasitpfaiagfqaltalsttedptrasipfdkdrngfvmgegsgmlvle
    slehaekrgatilaevvgygntcdayhmtsphpegqgaikaiklaleeaeispeqvayvn
    ahgtstpanekgesgaivavlgkevpvsstksftghllgaagaveaivtieamrhnfvpm
    tagtsevsdyieanvvygqglekeipyaisntfgfgghnavlafkrwe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oxhB (B:)
    gsshhhhhhssglvprgshmklnrvvvtgygvtspigntpeefwnslatgkigiggitkf
    dhsdfdvhnaaeiqdfpfdkyfvkkdtnrfdnyslyalyaaqeavnhanldvealnrdrf
    gvivasgiggikeiedqvlrlhekgpkrvkpmtlpkalpnmasgnvamrfgangvcksin
    tacsssndaigdafrsikfgfqdvmlvggteasitpfaiagfqaltalsttedptrasip
    fdkdrngfvmgegsgmlvleslehaekrgatilaevvgygntcdayhmtsphpegqgaik
    aiklaleeaeispeqvayvnahgtstpanekgesgaivavlgkevpvsstksftghllga
    agaveaivtieamrhnfvpmtagtsevsdyieanvvygqglekeipyaisntfgfgghna
    vlafkrwenr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oxhB (B:)
    klnrvvvtgygvtspigntpeefwnslatgkigiggitkfdhsdfdvhnaaeiqdfpfdk
    yfvkkdtnrfdnyslyalyaaqeavnhanldvealnrdrfgvivasgiggikeiedqvlr
    lhekgpkrvkpmtlpkalpnmasgnvamrfgangvcksintacsssndaigdafrsikfg
    fqdvmlvggteasitpfaiagfqaltalsttedptrasipfdkdrngfvmgegsgmlvle
    slehaekrgatilaevvgygntcdayhmtsphpegqgaikaiklaleeaeispeqvayvn
    ahgtstpanekgesgaivavlgkevpvsstksftghllgaagaveaivtieamrhnfvpm
    tagtsevsdyieanvvygqglekeipyaisntfgfgghnavlafkrwe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1oxhC (C:)
    gsshhhhhhssglvprgshmklnrvvvtgygvtspigntpeefwnslatgkigiggitkf
    dhsdfdvhnaaeiqdfpfdkyfvkkdtnrfdnyslyalyaaqeavnhanldvealnrdrf
    gvivasgiggikeiedqvlrlhekgpkrvkpmtlpkalpnmasgnvamrfgangvcksin
    tacsssndaigdafrsikfgfqdvmlvggteasitpfaiagfqaltalsttedptrasip
    fdkdrngfvmgegsgmlvleslehaekrgatilaevvgygntcdayhmtsphpegqgaik
    aiklaleeaeispeqvayvnahgtstpanekgesgaivavlgkevpvsstksftghllga
    agaveaivtieamrhnfvpmtagtsevsdyieanvvygqglekeipyaisntfgfgghna
    vlafkrwenr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oxhC (C:)
    klnrvvvtgygvtspigntpeefwnslatgkigiggitkfdhsdfdvhnaaeiqdfpfdk
    yfvkkdtnrfdnyslyalyaaqeavnhanldvealnrdrfgvivasgiggikeiedqvlr
    lhekgpkrvkpmtlpkalpnmasgnvamrfgangvcksintacsssndaigdafrsikfg
    fqdvmlvggteasitpfaiagfqaltalsttedptrasipfdkdrngfvmgegsgmlvle
    slehaekrgatilaevvgygntcdayhmtsphpegqgaikaiklaleeaeispeqvayvn
    ahgtstpanekgesgaivavlgkevpvsstksftghllgaagaveaivtieamrhnfvpm
    tagtsevsdyieanvvygqglekeipyaisntfgfgghnavlafkrwe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1oxhD (D:)
    gsshhhhhhssglvprgshmklnrvvvtgygvtspigntpeefwnslatgkigiggitkf
    dhsdfdvhnaaeiqdfpfdkyfvkkdtnrfdnyslyalyaaqeavnhanldvealnrdrf
    gvivasgiggikeiedqvlrlhekgpkrvkpmtlpkalpnmasgnvamrfgangvcksin
    tacsssndaigdafrsikfgfqdvmlvggteasitpfaiagfqaltalsttedptrasip
    fdkdrngfvmgegsgmlvleslehaekrgatilaevvgygntcdayhmtsphpegqgaik
    aiklaleeaeispeqvayvnahgtstpanekgesgaivavlgkevpvsstksftghllga
    agaveaivtieamrhnfvpmtagtsevsdyieanvvygqglekeipyaisntfgfgghna
    vlafkrwenr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oxhD (D:)
    klnrvvvtgygvtspigntpeefwnslatgkigiggitkfdhsdfdvhnaaeiqdfpfdk
    yfvkkdtnrfdnyslyalyaaqeavnhanldvealnrdrfgvivasgiggikeiedqvlr
    lhekgpkrvkpmtlpkalpnmasgnvamrfgangvcksintacsssndaigdafrsikfg
    fqdvmlvggteasitpfaiagfqaltalsttedptrasipfdkdrngfvmgegsgmlvle
    slehaekrgatilaevvgygntcdayhmtsphpegqgaikaiklaleeaeispeqvayvn
    ahgtstpanekgesgaivavlgkevpvsstksftghllgaagaveaivtieamrhnfvpm
    tagtsevsdyieanvvygqglekeipyaisntfgfgghnavlafkrwe