PDB entry 1oxd

View 1oxd on RCSB PDB site
Description: Expansion of the Genetic Code Enables Design of a Novel "Gold" Class of Green Fluorescent Proteins
Class: luminescent protein
Keywords: green fluorescent protein, chromophore, amino acid incorporation, tryptophan, genetic code, LUMINESCENT PROTEIN
Deposited on 2003-04-02, released 2003-12-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-09-14, with a file datestamp of 2011-09-09.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.214
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cyan fluorescent protein cfp
  Species: cfp marker plasmid pWM1009 [TaxId:141850]
  Database cross-references and differences (RAF-indexed):
  • GB AAG34040 (0-228)
    • chromophore (65)
    • engineered (79)
  Domains in SCOPe 2.05: d1oxda_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1oxdA (A:)
  mskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
  vttltwgvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlv
  nrielkgidfkedgnilghkleynyishnvyitadkqkngikanfkirhniedgsvqlad
  hyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi