PDB entry 1oxc

View 1oxc on RCSB PDB site
Description: LecB (PA-LII) in complex with FUCOSE
Class: sugar binding protein
Keywords: lectin, carbohydrate
Deposited on 2003-04-02, released 2003-09-09
The last revision prior to the SCOP 1.73 freeze date was dated 2003-09-09, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.174
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein LecB
    Species: Pseudomonas aeruginosa
    Gene: LecB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1oxca_
  • Chain 'B':
    Compound: hypothetical protein LecB
    Species: Pseudomonas aeruginosa
    Gene: LecB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1oxcb_
  • Chain 'C':
    Compound: hypothetical protein LecB
    Species: Pseudomonas aeruginosa
    Gene: LecB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1oxcc_
  • Chain 'D':
    Compound: hypothetical protein LecB
    Species: Pseudomonas aeruginosa
    Gene: LecB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1oxcd_
  • Heterogens: FUL, FUC, CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1oxcA (A:)
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1oxcB (B:)
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1oxcC (C:)
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1oxcD (D:)
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg