PDB entry 1oxc

View 1oxc on RCSB PDB site
Description: lecb (pa-lii) in complex with fucose
Deposited on 2003-04-02, released 2003-09-09
The last revision prior to the SCOP 1.71 freeze date was dated 2003-09-09, with a file datestamp of 2003-09-09.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.174
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1oxca_
  • Chain 'B':
    Domains in SCOP 1.71: d1oxcb_
  • Chain 'C':
    Domains in SCOP 1.71: d1oxcc_
  • Chain 'D':
    Domains in SCOP 1.71: d1oxcd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oxcA (A:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oxcB (B:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oxcC (C:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oxcD (D:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg