PDB entry 1ox9

View 1ox9 on RCSB PDB site
Description: Crystal structure of SspB-ssrA complex
Deposited on 2003-04-01, released 2003-08-26
The last revision prior to the SCOP 1.69 freeze date was dated 2003-08-26, with a file datestamp of 2003-08-26.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.243
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ox9a_
  • Chain 'B':
    Domains in SCOP 1.69: d1ox9b_
  • Chain 'C':
    Domains in SCOP 1.69: d1ox9c_
  • Chain 'D':
    Domains in SCOP 1.69: d1ox9d_
  • Chain 'E':
    Domains in SCOP 1.69: d1ox9e_
  • Chain 'F':
    Domains in SCOP 1.69: d1ox9f_
  • Chain 'G':
    Domains in SCOP 1.69: d1ox9g_
  • Chain 'H':
    Domains in SCOP 1.69: d1ox9h_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ox9A (A:)
    sqltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnl
    elandevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ox9B (B:)
    sqltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnl
    elandevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ox9C (C:)
    sqltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnl
    elandevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ox9D (D:)
    sqltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnl
    elandevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ox9E (E:)
    sqltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnl
    elandevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ox9F (F:)
    sqltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnl
    elandevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ox9G (G:)
    sqltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnl
    elandevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ox9H (H:)
    sqltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnl
    elandevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd