PDB entry 1ox9
View 1ox9 on RCSB PDB site
Description: Crystal structure of SspB-ssrA complex
Class: hydrolase activator
Keywords: SspB-ssrA, HYDROLASE ACTIVATOR
Deposited on
2003-04-01, released
2003-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.243
AEROSPACI score: 0.22
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Stringent starvation protein B
Species: Escherichia coli [TaxId:83334]
Gene: SSPB OR B3228 OR Z4586 OR ECS4101
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1ox9a_ - Chain 'B':
Compound: Stringent starvation protein B
Species: Escherichia coli [TaxId:83334]
Gene: SSPB OR B3228 OR Z4586 OR ECS4101
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1ox9b_ - Chain 'C':
Compound: Stringent starvation protein B
Species: Escherichia coli [TaxId:83334]
Gene: SSPB OR B3228 OR Z4586 OR ECS4101
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1ox9c_ - Chain 'D':
Compound: Stringent starvation protein B
Species: Escherichia coli [TaxId:83334]
Gene: SSPB OR B3228 OR Z4586 OR ECS4101
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1ox9d_ - Chain 'E':
Compound: Stringent starvation protein B
Species: Escherichia coli [TaxId:83334]
Gene: SSPB OR B3228 OR Z4586 OR ECS4101
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1ox9e_ - Chain 'F':
Compound: Stringent starvation protein B
Species: Escherichia coli [TaxId:83334]
Gene: SSPB OR B3228 OR Z4586 OR ECS4101
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1ox9f_ - Chain 'G':
Compound: Stringent starvation protein B
Species: Escherichia coli [TaxId:83334]
Gene: SSPB OR B3228 OR Z4586 OR ECS4101
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1ox9g_ - Chain 'H':
Compound: Stringent starvation protein B
Species: Escherichia coli [TaxId:83334]
Gene: SSPB OR B3228 OR Z4586 OR ECS4101
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1ox9h_ - Chain 'I':
Compound: ssrA
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'J':
Compound: ssrA
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'K':
Compound: ssrA
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'L':
Compound: ssrA
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'M':
Compound: ssrA
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'N':
Compound: ssrA
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'O':
Compound: ssrA
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'P':
Compound: ssrA
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1ox9A (A:)
sqltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnl
elandevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1ox9B (B:)
sqltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnl
elandevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1ox9C (C:)
sqltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnl
elandevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1ox9D (D:)
sqltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnl
elandevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>1ox9E (E:)
sqltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnl
elandevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
- Chain 'F':
Sequence; same for both SEQRES and ATOM records: (download)
>1ox9F (F:)
sqltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnl
elandevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
- Chain 'G':
Sequence; same for both SEQRES and ATOM records: (download)
>1ox9G (G:)
sqltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnl
elandevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
- Chain 'H':
Sequence; same for both SEQRES and ATOM records: (download)
>1ox9H (H:)
sqltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnl
elandevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
- Chain 'I':
No sequence available.
- Chain 'J':
No sequence available.
- Chain 'K':
No sequence available.
- Chain 'L':
No sequence available.
- Chain 'M':
No sequence available.
- Chain 'N':
No sequence available.
- Chain 'O':
No sequence available.
- Chain 'P':
No sequence available.