PDB entry 1ox9

View 1ox9 on RCSB PDB site
Description: Crystal structure of SspB-ssrA complex
Class: hydrolase activator
Keywords: SspB-ssrA, HYDROLASE ACTIVATOR
Deposited on 2003-04-01, released 2003-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.243
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Stringent starvation protein B
    Species: Escherichia coli [TaxId:83334]
    Gene: SSPB OR B3228 OR Z4586 OR ECS4101
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ox9a_
  • Chain 'B':
    Compound: Stringent starvation protein B
    Species: Escherichia coli [TaxId:83334]
    Gene: SSPB OR B3228 OR Z4586 OR ECS4101
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ox9b_
  • Chain 'C':
    Compound: Stringent starvation protein B
    Species: Escherichia coli [TaxId:83334]
    Gene: SSPB OR B3228 OR Z4586 OR ECS4101
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ox9c_
  • Chain 'D':
    Compound: Stringent starvation protein B
    Species: Escherichia coli [TaxId:83334]
    Gene: SSPB OR B3228 OR Z4586 OR ECS4101
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ox9d_
  • Chain 'E':
    Compound: Stringent starvation protein B
    Species: Escherichia coli [TaxId:83334]
    Gene: SSPB OR B3228 OR Z4586 OR ECS4101
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ox9e_
  • Chain 'F':
    Compound: Stringent starvation protein B
    Species: Escherichia coli [TaxId:83334]
    Gene: SSPB OR B3228 OR Z4586 OR ECS4101
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ox9f_
  • Chain 'G':
    Compound: Stringent starvation protein B
    Species: Escherichia coli [TaxId:83334]
    Gene: SSPB OR B3228 OR Z4586 OR ECS4101
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ox9g_
  • Chain 'H':
    Compound: Stringent starvation protein B
    Species: Escherichia coli [TaxId:83334]
    Gene: SSPB OR B3228 OR Z4586 OR ECS4101
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ox9h_
  • Chain 'I':
    Compound: ssrA
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1OX9 (0-7)
  • Chain 'J':
    Compound: ssrA
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1OX9 (0-7)
  • Chain 'K':
    Compound: ssrA
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1OX9 (0-7)
  • Chain 'L':
    Compound: ssrA
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1OX9 (0-7)
  • Chain 'M':
    Compound: ssrA
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1OX9 (0-7)
  • Chain 'N':
    Compound: ssrA
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1OX9 (0-7)
  • Chain 'O':
    Compound: ssrA
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1OX9 (0-7)
  • Chain 'P':
    Compound: ssrA
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1OX9 (0-7)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ox9A (A:)
    sqltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnl
    elandevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ox9B (B:)
    sqltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnl
    elandevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ox9C (C:)
    sqltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnl
    elandevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ox9D (D:)
    sqltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnl
    elandevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ox9E (E:)
    sqltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnl
    elandevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ox9F (F:)
    sqltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnl
    elandevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ox9G (G:)
    sqltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnl
    elandevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ox9H (H:)
    sqltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnl
    elandevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.