PDB entry 1ox8

View 1ox8 on RCSB PDB site
Description: Crystal structure of SspB
Deposited on 2003-04-01, released 2003-08-26
The last revision prior to the SCOP 1.67 freeze date was dated 2003-08-26, with a file datestamp of 2003-08-26.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.248
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ox8a_
  • Chain 'B':
    Domains in SCOP 1.67: d1ox8b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ox8A (A:)
    qltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnle
    landevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ox8B (B:)
    qltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnle
    landevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd