PDB entry 1ox8

View 1ox8 on RCSB PDB site
Description: Crystal structure of SspB
Class: hydrolase activator
Keywords: RNA-binding property, HYDROLASE ACTIVATOR
Deposited on 2003-04-01, released 2003-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.248
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Stringent starvation protein B
  Species: Escherichia coli [TaxId:83334]
  Gene: SSPB OR B3228 OR Z4586 OR ECS4101
  Database cross-references and differences (RAF-indexed):
  • Uniprot P25663 (0-106)
    • modified residue (38)
    • modified residue (98)
  Domains in SCOPe 2.08: d1ox8a_
• Chain 'B':
  Compound: Stringent starvation protein B
  Species: Escherichia coli [TaxId:83334]
  Gene: SSPB OR B3228 OR Z4586 OR ECS4101
  Database cross-references and differences (RAF-indexed):
  • Uniprot P25663 (0-106)
    • modified residue (38)
    • modified residue (98)
  Domains in SCOPe 2.08: d1ox8b_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ox8A (A:)
  qltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnle
  landevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ox8B (B:)
  qltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnle
  landevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd