PDB entry 1ox7

View 1ox7 on RCSB PDB site
Description: Crystal structure of yeast cytosine deaminase apo-enzyme: inorganic zinc bound
Class: hydrolase
Keywords: aminohydrolase
Deposited on 2003-04-01, released 2003-08-19
The last revision prior to the SCOP 1.73 freeze date was dated 2003-08-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: 0.163
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytosine deaminase
    Species: Saccharomyces cerevisiae
    Gene: FCY1 OR YPR062W OR YP9499.17
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12178
      • modified residue (3)
      • modified residue (8)
      • modified residue (17)
      • modified residue (54)
      • modified residue (95)
      • modified residue (102)
      • modified residue (143)
    Domains in SCOP 1.73: d1ox7a_
  • Chain 'B':
    Compound: Cytosine deaminase
    Species: Saccharomyces cerevisiae
    Gene: FCY1 OR YPR062W OR YP9499.17
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12178 (3-160)
      • cloning artifact (0-2)
      • modified residue (3)
      • modified residue (8)
      • modified residue (17)
      • modified residue (54)
      • modified residue (95)
      • modified residue (102)
      • modified residue (143)
    Domains in SCOP 1.73: d1ox7b_
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ox7A (A:)
    gssmvtggmaskwdqkgmdiayeeaalgykeggvpiggclinnkdgsvlgrghnmrfqkg
    satlhgeistlencgrlegkvykdttlyttlspcdmctgaiimygiprcvvgenvnfksk
    gekylqtrghevvvvdderckkimkqfiderpqdwfedige
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ox7A (A:)
    mvtggmaskwdqkgmdiayeeaalgykeggvpiggclinnkdgsvlgrghnmrfqkgsat
    lhgeistlencgrlegkvykdttlyttlspcdmctgaiimygiprcvvgenvnfkskgek
    ylqtrghevvvvdderckkimkqfiderpqdwfedige
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ox7B (B:)
    gssmvtggmaskwdqkgmdiayeeaalgykeggvpiggclinnkdgsvlgrghnmrfqkg
    satlhgeistlencgrlegkvykdttlyttlspcdmctgaiimygiprcvvgenvnfksk
    gekylqtrghevvvvdderckkimkqfiderpqdwfedige