PDB entry 1ox3

View 1ox3 on RCSB PDB site
Description: crystal structure of mini-fibritin
Class: chaperone
Keywords: foldon, capping motif, CHAPERONE
Deposited on 2003-04-01, released 2004-04-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: -1.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibritin
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: WAC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10104 (Start-79)
    • Uniprot P10104 (80-108)
      • engineered mutation (103)
    Domains in SCOPe 2.08: d1ox3a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1ox3A (A:)
adivlndlpfvdgppaegqsriswikngeeilgadtqygsegsmnrptvsvlrnvevldk
nigilktsletansdiktiqeagyipeaprdgqayvrkdgewvllstfl

    Sequence, based on observed residues (ATOM records): (download) 
    >1ox3A (A:)
divlndlpfvdgppaegqsriswikngeeilgadtqygsegsmnrptvsvlrnvevldkn
igilktsletansdiktiqeagyipeaprdgqayvrkdgewvllstfl