PDB entry 1ox0

View 1ox0 on RCSB PDB site
Description: The crystal structure of beta-ketoacyl-[acyl carrier protein] synthase II from Streptococcus pneumoniae
Class: transferase
Keywords: transferase
Deposited on 2003-03-31, released 2003-04-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.138
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta ketoacyl-acyl carrier protein synthase
    Species: Streptococcus pneumoniae [TaxId:1313]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FBC2 (19-End)
      • cloning artifact (14-18)
    Domains in SCOPe 2.06: d1ox0a1, d1ox0a2, d1ox0a3
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ox0A (A:)
    gsshhhhhhssglvprgshmklnrvvvtgygvtspigntpeefwnslatgkigiggitkf
    dhsdfdvhnaaeiqdfpfdkyfvkkdtnrfdnyslyalyaaqeavnhanldvealnrdrf
    gvivasgiggikeiedqvlrlhekgpkrvkpmtlpkalpnmasgnvamrfgangvcksin
    tacsssndaigdafrsikfgfqdvmlvggteasitpfaiagfqaltalsttedptrasip
    fdkdrngfvmgegsgmlvleslehaekrgatilaevvgygntcdayhmtsphpegqgaik
    aiklaleeaeispeqvayvnahgtstpanekgesgaivavlgkevpvsstksftghllga
    agaveaivtieamrhnfvpmtagtsevsdyieanvvygqglekeipyaisntfgfgghna
    vlafkrwenr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ox0A (A:)
    prgshmklnrvvvtgygvtspigntpeefwnslatgkigiggitkfdhsdfdvhnaaeiq
    dfpfdkyfvkkdtnrfdnyslyalyaaqeavnhanldvealnrdrfgvivasgiggikei
    edqvlrlhekgpkrvkpmtlpkalpnmasgnvamrfgangvcksintacsssndaigdaf
    rsikfgfqdvmlvggteasitpfaiagfqaltalsttedptrasipfdkdrngfvmgegs
    gmlvleslehaekrgatilaevvgygntcdayhmtsphpegqgaikaiklaleeaeispe
    qvayvnahgtstpanekgesgaivavlgkevpvsstksftghllgaagaveaivtieamr
    hnfvpmtagtsevsdyieanvvygqglekeipyaisntfgfgghnavlafkrwe