PDB entry 1owx

View 1owx on RCSB PDB site
Description: Solution structure of the C-terminal RRM of human La (La225-334)
Deposited on 2003-03-31, released 2003-07-29
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-29, with a file datestamp of 2003-07-29.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1owxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1owxA (A:)
    mrgshhhhhhgsleekigcllkfsgdlddqtcredlhilfsnhgeikwidfvrgakegii
    lfkekakealgkakdanngnlqlrnkevtwevlegevekealkkiiedqqeslnkwkskg
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >1owxA (A:)
    hhgsleekigcllkfsgdlddqtcredlhilfsnhgeikwidfvrgakegiilfkekake
    algkakdanngnlqlrnkevtwevlegevekealkkiiedqqeslnkwkskgr