PDB entry 1owx

View 1owx on RCSB PDB site
Description: Solution structure of the C-terminal RRM of human La (La225-334)
Class: transcription
Keywords: rrm, transcription
Deposited on 2003-03-31, released 2003-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lupus La protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ssb
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05455 (11-120)
      • cloning artifact (8-10)
      • cloning artifact (44)
    Domains in SCOPe 2.07: d1owxa1, d1owxa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1owxA (A:)
    mrgshhhhhhgsleekigcllkfsgdlddqtcredlhilfsnhgeikwidfvrgakegii
    lfkekakealgkakdanngnlqlrnkevtwevlegevekealkkiiedqqeslnkwkskg
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >1owxA (A:)
    hhgsleekigcllkfsgdlddqtcredlhilfsnhgeikwidfvrgakegiilfkekake
    algkakdanngnlqlrnkevtwevlegevekealkkiiedqqeslnkwkskgr